TRERF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256238

Catalog No. NBP256238

Description

TRERF1 Polyclonal specifically detects TRERF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TRERF1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BCAR2, Breast cancer estrogen resistance 2RAPAHSA277276, dJ139D8.5, FLJ21198, rapa-1, rapa-2, RP1-139D8.5, transcriptional regulating factor 1, transcriptional regulating protein 132, transcriptional-regulating factor 1, Transcriptional-regulating protein 132, TReP-132, TREP132, Zinc finger protein rapa, Zinc finger transcription factor TReP-132
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55809
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TRERF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only