TREX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP189202

Catalog No. NBP189202

Description

TREX1 Polyclonal specifically detects TREX1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TREX1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 3'-5' exonuclease TREX1, AGS1, Aicardi-Goutieres syndrome 1, CRV, DKFZp434J0310, DNase III, DRN3, EC 3.1.11.2, HERNS, three prime repair exonuclease 1,3' repair exonuclease 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TREX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TREX1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
• Quantity: 0.1 mL
• Research Discipline: DNA Repair, Editing and Processing Endonucleases
• Gene ID (Entrez): 11277
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only