Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TREX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$610.00
Specifications
| Antigen | TREX1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TREX1 Polyclonal specifically detects TREX1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TREX1 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Editing and Processing Endonucleases | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11277 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| 3'-5' exonuclease TREX1, AGS1, Aicardi-Goutieres syndrome 1, CRV, DKFZp434J0310, DNase III, DRN3, EC 3.1.11.2, HERNS, three prime repair exonuclease 1,3' repair exonuclease 1 | |
| TREX1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human TREX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title