Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301245

TRIF/TICAM1 Antibody, Novus Biologicals™
SDP

Catalog No. NB301245 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301245 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301245 Supplier Novus Biologicals Supplier No. NBP325207
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TRIF/TICAM1 Polyclonal antibody specifically detects TRIF/TICAM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen TRIF/TICAM1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias MGC35334, Proline-rich, vinculin and TIR domain-containing protein B, PRVTIRBTIR domain-containing adapter protein inducing IFN-beta, Putative NF-kappa-B-activating protein 502H, TICAM-1TIR domain containing adaptor inducing interferon-beta, TIR domain-containing adapter molecule 1, TIR domain-containing adaptor molecule 1, toll-like receptor adaptor molecule 1, TRIFToll-interleukin-1 receptor domain-containing adapter protein inducinginterferon beta
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein TRIF/TICAM1 using the following amino acid sequence: RLDKHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARM
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 148022
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.