Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRIM Rabbit anti-Human, Polyclonal, Novus Biologicals™

TRIM Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169269 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169269 25 μg
NB169268 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB169269 Supplier Novus Biologicals Supplier No. NBP31709625UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TRIM Polyclonal antibody specifically detects TRIM in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen TRIM
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias pp29/30, T cell receptor associated transmembrane adaptor 1, T cell receptor interacting molecule, T-cell receptor interacting molecule, T-cell receptor-associated transmembrane adapter 1, T-cell receptor-interacting molecule, TCRIM, TRIMHSPC062
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Adaptive Immunity, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 50852
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.