Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM13 Antibody, Novus Biologicals™
SDP

Catalog No. NB432402 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432402 25ul
NBP185016 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432402 Supplier Novus Biologicals Supplier No. NBP18501625UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TRIM13 Polyclonal specifically detects TRIM13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TRIM13
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias B-cell chronic lymphocytic leukemia tumor suppressor Leu5, CLL-associated RING finger, E3 ubiquitin-protein ligase TRIM13, EC 6.3.2.-, LEU5CAR, Leukemia-associated protein 5, Putative tumor suppressor RFP2, Ret finger protein 2RING finger protein 77, RFP2DLEU5, RNF77Leu5, tripartite motif containing 13, tripartite motif protein 13, tripartite motif-containing 13, Tripartite motif-containing protein 13
Gene Symbols TRIM13
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 10206
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.