Trim22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180311

Catalog No. NBP180311

Description

Trim22 Polyclonal specifically detects Trim22 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Trim22
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 50 kDa-stimulated trans-acting factor, E3 ubiquitin-protein ligase TRIM22, EC 6.3.2, EC 6.3.2.-, GPSTAF50, RING finger protein 94, RNF94stimulated trans-acting factor (50 kDa), Staf-50, STAF50staf-50, tripartite binding motif 22, tripartite motif containing 22, tripartite motif protein TRIM22, tripartite motif-containing 22, Tripartite motif-containing protein 22
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_006065
• Gene Symbols: TRIM22
• Immunogen: Synthetic peptide directed towards the middle region of human TRIM22. Peptide sequence VDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYW.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 10346
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.