Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Trim22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Trim22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Trim22 Polyclonal specifically detects Trim22 in Human samples. It is validated for Western Blot.Specifications
| Trim22 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| 50 kDa-stimulated trans-acting factor, E3 ubiquitin-protein ligase TRIM22, EC 6.3.2, EC 6.3.2.-, GPSTAF50, RING finger protein 94, RNF94stimulated trans-acting factor (50 kDa), Staf-50, STAF50staf-50, tripartite binding motif 22, tripartite motif containing 22, tripartite motif protein TRIM22, tripartite motif-containing 22, Tripartite motif-containing protein 22 | |
| TRIM22 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_006065 | |
| 10346 | |
| Synthetic peptide directed towards the middle region of human TRIM22. Peptide sequence VDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYW. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title