Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18035920UL
Description
TRIM34 Polyclonal specifically detects TRIM34 in Human samples. It is validated for Western Blot.Specifications
TRIM34 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_569074 | |
TRIM34 | |
Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV. | |
20 μL | |
Zinc Finger | |
53840 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 6.3.2, interferon-responsive, Interferon-responsive finger protein 1, RING finger protein 21, RNF21tripartite motif-containing protein 34, tripartite motif containing 34, tripartite motif-containing 34 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction