Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	TRIM34
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18035920 View Documents View Product Certificates	Novus Biologicals NBP18035920UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180359 View Documents View Product Certificates	Novus Biologicals NBP180359	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TRIM34 Polyclonal specifically detects TRIM34 in Human samples. It is validated for Western Blot.

Specifications

Antigen	TRIM34
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Zinc Finger
Gene Accession No.	NP_569074
Gene ID (Entrez)	53840
Immunogen	Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	EC 6.3.2, interferon-responsive, Interferon-responsive finger protein 1, RING finger protein 21, RNF21tripartite motif-containing protein 34, tripartite motif containing 34, tripartite motif-containing 34
Gene Symbols	TRIM34
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TRIM34 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents