TRIM34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180050

Catalog No. NBP180050

Description

TRIM34 Polyclonal specifically detects TRIM34 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRIM34
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2, interferon-responsive, Interferon-responsive finger protein 1, RING finger protein 21, RNF21tripartite motif-containing protein 34, tripartite motif containing 34, tripartite motif-containing 34
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 53840
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_569074
• Gene Symbols: TRIM34
• Immunogen: Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence SMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Rat: 85%; Horse: 79%.
• Target Species: Human, Rat, Equine
• Isotype: IgG