Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM56 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18037220UL
Description
TRIM56 Polyclonal specifically detects TRIM56 in Human samples. It is validated for Western Blot.Specifications
TRIM56 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_112223 | |
TRIM56 | |
Synthetic peptide directed towards the middle region of human TRIM56. Peptide sequence DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS. | |
20 μL | |
Zinc Finger | |
81844 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DKFZp667O116, E3 ubiquitin-protein ligase TRIM56, EC 6.3.2.-, RING finger protein 109, RNF109FLJ35608, tripartite motif containing 56, tripartite motif-containing 56, Tripartite motif-containing protein 56 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction