Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM56 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TRIM56 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180372
|
Novus Biologicals
NBP180372 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP18037220
|
Novus Biologicals
NBP18037220UL |
20 μL | N/A | N/A | N/A | ||||
Description
TRIM56 Polyclonal specifically detects TRIM56 in Human samples. It is validated for Western Blot.Specifications
| TRIM56 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| DKFZp667O116, E3 ubiquitin-protein ligase TRIM56, EC 6.3.2.-, RING finger protein 109, RNF109FLJ35608, tripartite motif containing 56, tripartite motif-containing 56, Tripartite motif-containing protein 56 | |
| TRIM56 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_112223 | |
| 81844 | |
| Synthetic peptide directed towards the middle region of human TRIM56. Peptide sequence DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title