Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM56 Antibody, Novus Biologicals™
SDP

Catalog No. p-7109950 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180372 100 μL
NBP18037220 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP180372 Supplier Novus Biologicals Supplier No. NBP180372
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TRIM56 Polyclonal specifically detects TRIM56 in Human samples. It is validated for Western Blot.

Specifications

Antigen TRIM56
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_112223
Gene Alias DKFZp667O116, E3 ubiquitin-protein ligase TRIM56, EC 6.3.2.-, RING finger protein 109, RNF109FLJ35608, tripartite motif containing 56, tripartite motif-containing 56, Tripartite motif-containing protein 56
Gene Symbols TRIM56
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human TRIM56. Peptide sequence DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 81844
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.