TRIM59 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159777

Catalog No. NBP159777

Description

TRIM59 Polyclonal specifically detects TRIM59 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRIM59
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC129860, MGC129861, Mrf1, RING finger protein 104, RNF104MGC26631, TRIM57, tripartite motif containing 59, tripartite motif-containing 57, tripartite motif-containing 59, tripartite motif-containing protein 59, TSBF1MRF1, tumor suppressor TSBF1, Tumor suppressor TSBF-1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 286827
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q8IWR1
• Gene Symbols: TRIM59
• Immunogen: Synthetic peptides corresponding to TRIM59(tripartite motif-containing 59) The peptide sequence was selected from the middle region of TRIM59. Peptide sequence LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Equine: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

For Research Use Only