Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM59 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159777 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159777 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159777 Supplier Novus Biologicals Supplier No. NBP159777
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TRIM59 Polyclonal specifically detects TRIM59 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

Antigen TRIM59
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IWR1
Gene Alias MGC129860, MGC129861, Mrf1, RING finger protein 104, RNF104MGC26631, TRIM57, tripartite motif containing 59, tripartite motif-containing 57, tripartite motif-containing 59, tripartite motif-containing protein 59, TSBF1MRF1, tumor suppressor TSBF1, Tumor suppressor TSBF-1
Gene Symbols TRIM59
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRIM59(tripartite motif-containing 59) The peptide sequence was selected from the middle region of TRIM59. Peptide sequence LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 286827
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Equine: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.