Triosephosphate isomerase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152881

Catalog No. NBP152881

Description

Triosephosphate isomerase Polyclonal specifically detects Triosephosphate isomerase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Triosephosphate isomerase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 5.3.1.1, MGC88108, TIM, TPI, triosephosphate isomerase, Triose-phosphate isomerase, triosephosphate isomerase 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 27 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 7167
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P60174
• Gene Symbols: TPI1
• Immunogen: Synthetic peptides corresponding to TPI1(triosephosphate isomerase 1) The peptide sequence was selected from the N terminal of TPI1. Peptide sequence MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Equine: 86%; Canine: 79%; Bovine: 79%; .
• Target Species: Human, Mouse, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG