Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Triosephosphate isomerase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15288120UL
Description
Triosephosphate isomerase Polyclonal specifically detects Triosephosphate isomerase in Human, Mouse samples. It is validated for Western Blot.Specifications
Triosephosphate isomerase | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P60174 | |
TPI1 | |
Synthetic peptides corresponding to TPI1(triosephosphate isomerase 1) The peptide sequence was selected from the N terminal of TPI1. Peptide sequence MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID. | |
Affinity Purified | |
RUO | |
Primary | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 5.3.1.1, MGC88108, TIM, TPI, triosephosphate isomerase, Triose-phosphate isomerase, triosephosphate isomerase 1 | |
Rabbit | |
27 kDa | |
20 μL | |
Stem Cell Markers | |
7167 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction