Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP184873 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP184873 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP184873 Supplier Novus Biologicals Supplier No. NBP184873
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TRIP1 Polyclonal specifically detects TRIP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen TRIP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias eIF-3-beta, eIF3-beta, eIF3i, eIF3-p36, EIF3S2TGF-beta receptor-interacting protein 1, Eukaryotic translation initiation factor 3 subunit 2, eukaryotic translation initiation factor 3 subunit I, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa, eukaryotic translation initiation factor 3, subunit I, predicted protein of HQ2242, TGFbeta receptor-interacting protein 1, TRIP-1, TRIP-1eIF3 p36, TRIP1PRO2242
Gene Symbols EIF3I
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 8668
Test Specificity Specificity of human TRIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.