TrkA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238265

Catalog No. NBP238265

Description

TrkA Polyclonal specifically detects TrkA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TrkA
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P04629
• Gene Symbols: NTRK1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG
• Quantity: 0.1 mL
• Research Discipline: Adaptive Immunity, Cancer, Immunology, Neuroscience, Protein Kinase
• Gene ID (Entrez): 4914
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp781I14186, EC 2.7.10, EC 2.7.10.1, MTChigh affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, neurotrophic tyrosine kinase, receptor, type 1, p140-TrkA, TRK1-transforming tyrosine kinase protein, Trk-A, TRKAOncogene TRK, TRKTRK1, tyrosine kinase receptor A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.