TrkC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255927

Catalog No. NBP255927

Description

TrkC Polyclonal specifically detects TrkC in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TrkC
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3 growth factor receptor, Trk-C, TrkC tyrosine kinase, TRKCneurotrophin 3 receptor, tyrosine kinase receptor C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NTRK3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI
• Quantity: 100 μL
• Research Discipline: Cancer, Protein Kinase
• Gene ID (Entrez): 4916
• Target Species: Human
• Isotype: IgG

For Research Use Only