TRMT61A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155087

Catalog No. NBP155087

Description

TRMT61A Polyclonal specifically detects TRMT61A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRMT61A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C14orf172, chromosome 14 open reading frame 172, EC 2.1.1.36, FLJ40452, GCD14, Gcd14p, hTRM61, TRM61, tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61, tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A, tRNA methyltransferase 61 homolog A (S. cerevisiae), tRNA(m1A58)-methyltransferase subunit TRM61, tRNA(m1A58)-methyltransferase subunit TRMT61A, tRNA(m1A58)MTase subunit TRM61, tRNA(m1A58)MTase subunit TRMT61A
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: TRMT61A.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96FX7
• Gene Symbols: TRMT61A
• Immunogen: Synthetic peptides corresponding to C14ORF172 The peptide sequence was selected from the N terminal of C14ORF172. Peptide sequence MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 115708
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.