Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRMT61A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$501.50
Specifications
| Antigen | TRMT61A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRMT61A Polyclonal specifically detects TRMT61A in Human samples. It is validated for Western Blot.Specifications
| TRMT61A | |
| Polyclonal | |
| Rabbit | |
| Q96FX7 | |
| 115708 | |
| Synthetic peptides corresponding to C14ORF172 The peptide sequence was selected from the N terminal of C14ORF172. Peptide sequence MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI. | |
| Primary | |
| 31 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C14orf172, chromosome 14 open reading frame 172, EC 2.1.1.36, FLJ40452, GCD14, Gcd14p, hTRM61, TRM61, tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61, tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A, tRNA methyltransferase 61 homolog A (S. cerevisiae), tRNA(m1A58)-methyltransferase subunit TRM61, tRNA(m1A58)-methyltransferase subunit TRMT61A, tRNA(m1A58)MTase subunit TRM61, tRNA(m1A58)MTase subunit TRMT61A | |
| TRMT61A | |
| IgG | |
| This product is specific to Subunit or Isoform: TRMT61A. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title