Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Tropomyosin-1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15288720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15288720 20 μL
NBP152887 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15288720 Supplier Novus Biologicals Supplier No. NBP15288720UL

Rabbit Polyclonal Antibody

Tropomyosin-1 Polyclonal specifically detects Tropomyosin-1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Tropomyosin-1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q7Z6L8
Gene Alias alpha tropomyosin, alpha-tropomyosin, C15orf13, cardiomyopathy, hypertrophic 3, chromosome 15 open reading frame 13, CMD1Y, CMH3, HTM-alpha, sarcomeric tropomyosin kappa, TMSA, tropomyosin 1 (alpha), tropomyosin 1 (alpha) isoform 1, tropomyosin 1 (alpha) isoform 2, tropomyosin 1 (alpha) isoform 3, tropomyosin 1 (alpha) isoform 4, tropomyosin 1 (alpha) isoform 5, tropomyosin 1 (alpha) isoform 6, tropomyosin 1 (alpha) isoform 7, tropomyosin alpha-1 chain, Tropomyosin-1
Gene Symbols TPM1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TPM1(tropomyosin 1 (alpha)) The peptide sequence was selected from the middle region of TPM1. Peptide sequence LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cytoskeleton Markers
Primary or Secondary Primary
Gene ID (Entrez) 7168
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.