TrpC2-like protein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21472625UL

Catalog No. NB437744

Description

TrpC2-like protein Polyclonal specifically detects TrpC2-like protein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TrpC2-like protein
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Gene Alias: LOC100133315 transient receptor potential cation channel, subfamily C, member 2-like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 100133315
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LOC100133315
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only