TRPM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159618

Catalog No. NBP159618

Description

TRPM2 Polyclonal specifically detects TRPM2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRPM2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient receptor potential cation channel, subfamily M, member 2, Transient receptor potential channel 7, TrpC7
• Host Species: Rabbit
• Molecular Weight of Antigen: 171 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cell Biology, Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neuroscience, Neurotransmission, Signal Transduction
• Gene ID (Entrez): 7226
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O94759
• Gene Symbols: TRPM2
• Immunogen: Synthetic peptides corresponding to TRPM2(transient receptor potential cation channel, subfamily M, member 2) The peptide sequence was selected from the N terminal of TRPM2. Peptide sequence VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Porcine 88%, Canine 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only