Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRPM2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159618 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159618 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159618 Supplier Novus Biologicals Supplier No. NBP159618
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TRPM2 Polyclonal specifically detects TRPM2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TRPM2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O94759
Gene Alias EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient receptor potential cation channel, subfamily M, member 2, Transient receptor potential channel 7, TrpC7
Gene Symbols TRPM2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRPM2(transient receptor potential cation channel, subfamily M, member 2) The peptide sequence was selected from the N terminal of TRPM2. Peptide sequence VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 171 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cell Biology, Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neuroscience, Neurotransmission, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7226
Test Specificity Expected identity based on immunogen sequence: Porcine 88%, Canine 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.