Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRPM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32137125UL
Description
TRPM3 Polyclonal antibody specifically detects TRPM3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
TRPM3 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
EC 2.3.1.31, EC 5.99.1.3, Long transient receptor potential channel 3, LTrpC3, LTrpC-3, LTRPC3KIAA1616MLSN2GON-2, melastatin 2, melastatin-2, transient receptor potential cation channel subfamily M member 3, transient receptor potential cation channel, subfamily M, member 3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ | |
25 μg | |
Signal Transduction | |
80036 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction