TRPM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180210

Catalog No. NBP180210

Description

TRPM3 Polyclonal specifically detects TRPM3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRPM3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.3.1.31, EC 5.99.1.3, Long transient receptor potential channel 3, LTrpC3, LTrpC-3, LTRPC3KIAA1616MLSN2GON-2, melastatin 2, melastatin-2, transient receptor potential cation channel subfamily M member 3, transient receptor potential cation channel, subfamily M, member 3
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: AAH94699
• Gene Symbols: TRPM3
• Immunogen: Synthetic peptide directed towards the N terminal of human TRPM3. Peptide sequence YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 80036
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG