Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRPM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TRPM3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
TRPM3 Polyclonal specifically detects TRPM3 in Human samples. It is validated for Western Blot.Specifications
TRPM3 | |
Polyclonal | |
Purified | |
RUO | |
EC 2.3.1.31, EC 5.99.1.3, Long transient receptor potential channel 3, LTrpC3, LTrpC-3, LTRPC3KIAA1616MLSN2GON-2, melastatin 2, melastatin-2, transient receptor potential cation channel subfamily M member 3, transient receptor potential cation channel, subfamily M, member 3 | |
TRPM3 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
AAH94699 | |
80036 | |
Synthetic peptide directed towards the N terminal of human TRPM3. Peptide sequence YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title