TRPV6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174138

Catalog No. NBP174138

Description

TRPV6 Polyclonal specifically detects TRPV6 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRPV6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ABP/ZF, calcium channel CaT1, Calcium transport protein 1, CaT1, CaT-L, CATL, CaT-like, ECaC2, ECAC2caT-L, epithelial apical membrane calcium transporter/channel CaT1, Epithelial calcium channel 2Alu-binding protein with zinc finger domain, HSA277909, LP6728, transient receptor potential cation channel subfamily V member 6, transient receptor potential cation channel, subfamily V, member 6, TrpV6, ZFAB
• Host Species: Rabbit
• Molecular Weight of Antigen: 83 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9R186
• Gene Symbols: TRPV6
• Immunogen: Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55503
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG