Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRPV6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $489.50

Specifications

Antigen	TRPV6
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17413820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17413820UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP174138 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174138	100 μL	Each for $489.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TRPV6 Polyclonal specifically detects TRPV6 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	TRPV6
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ABP/ZF, calcium channel CaT1, Calcium transport protein 1, CaT1, CaT-L, CATL, CaT-like, ECaC2, ECAC2caT-L, epithelial apical membrane calcium transporter/channel CaT1, Epithelial calcium channel 2Alu-binding protein with zinc finger domain, HSA277909, LP6728, transient receptor potential cation channel subfamily V member 6, transient receptor potential cation channel, subfamily V, member 6, TrpV6, ZFAB
Gene Symbols	TRPV6
Isotype	IgG
Molecular Weight of Antigen	83 kDa

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9R186
Gene ID (Entrez)	55503
Immunogen	Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TRPV6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents