TRPV6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP17413820UL

Catalog No. NBP17413820

Description

TRPV6 Polyclonal specifically detects TRPV6 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRPV6
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
• Gene Accession No.: Q9R186
• Gene Symbols: TRPV6
• Immunogen: Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55503
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: ABP/ZF, calcium channel CaT1, Calcium transport protein 1, CaT1, CaT-L, CATL, CaT-like, ECaC2, ECAC2caT-L, epithelial apical membrane calcium transporter/channel CaT1, Epithelial calcium channel 2Alu-binding protein with zinc finger domain, HSA277909, LP6728, transient receptor potential cation channel subfamily V member 6, transient receptor potential cation channel, subfamily V, member 6, TrpV6, ZFAB
• Host Species: Rabbit
• Molecular Weight of Antigen: 83 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Isotype: IgG