Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRPV6 Antibody, Novus Biologicals™

TRPV6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17413820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17413820 20 μL
NBP174138 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17413820 Supplier Novus Biologicals Supplier No. NBP17413820UL

Description

Rabbit Polyclonal Antibody

TRPV6 Polyclonal specifically detects TRPV6 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen TRPV6
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9R186
Gene Alias ABP/ZF, calcium channel CaT1, Calcium transport protein 1, CaT1, CaT-L, CATL, CaT-like, ECaC2, ECAC2caT-L, epithelial apical membrane calcium transporter/channel CaT1, Epithelial calcium channel 2Alu-binding protein with zinc finger domain, HSA277909, LP6728, transient receptor potential cation channel subfamily V member 6, transient receptor potential cation channel, subfamily V, member 6, TrpV6, ZFAB
Gene Symbols TRPV6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC.
Molecular Weight of Antigen 83 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55503
Target Species Human, Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.