Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRUB2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156515 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156515 100 μL
NBP15651520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP156515 Supplier Novus Biologicals Supplier No. NBP156515
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TRUB2 Polyclonal specifically detects TRUB2 in Human samples. It is validated for Western Blot.

Specifications

Antigen TRUB2
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95900
Gene Alias CLONE24922, EC 5.4.99.-, probable tRNA pseudouridine synthase 2, RP11-339B21.1, TruB pseudouridine (psi) synthase homolog 2 (E. coli)
Gene Symbols TRUB2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRUB2(TruB pseudouridine (psi) synthase homolog 2 (E. coli)) The peptide sequence was selected from the middle region of TRUB2. Peptide sequence MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26995
Test Specificity Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Mouse: 100%; Canine: 92%; Rat: 92%; Chicken: 91%; Pig: 91%; Rabbit: 85%; Xenopus: 81%; Zebrafish: 81%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.