TSGA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP189839

Catalog No. NBP189839

Description

TSGA2 Polyclonal specifically detects TSGA2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TSGA2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Cancer/testis antigen 79, CT79, FLJ32753, h-meichroacidin, Male meiotic metaphase chromosome-associated acidic protein, Meichroacidin, radial spoke head 1 homolog, radial spoke head 1 homolog (Chlamydomonas), RSP44, RSPH10A, testes specific A2 homolog, testes specific gene A2 homolog, testis specific A2 homolog, testis specific A2 homolog (mouse), Testis-specific gene A2 protein, TSA2MGC126568, TSGA2MGC141927
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RSPH1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 89765
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only