Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSGA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
$382.00 - $646.00
Specifications
| Antigen | TSGA2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TSGA2 Polyclonal specifically detects TSGA2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TSGA2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 89765 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| Cancer/testis antigen 79, CT79, FLJ32753, h-meichroacidin, Male meiotic metaphase chromosome-associated acidic protein, Meichroacidin, radial spoke head 1 homolog, radial spoke head 1 homolog (Chlamydomonas), RSP44, RSPH10A, testes specific A2 homolog, testes specific gene A2 homolog, testis specific A2 homolog, testis specific A2 homolog (mouse), Testis-specific gene A2 protein, TSA2MGC126568, TSGA2MGC141927 | |
| RSPH1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title