Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSKS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154878
Description
TSKS Polyclonal specifically detects TSKS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TSKS | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| STK22 substrate 1, STK22S1, testis specific serine/threonine kinase substrate, Testis-specific kinase substrate, testis-specific serine kinase substrate, TSKS1, TSSKS | |
| Rabbit | |
| 65 kDa | |
| 100 μL | |
| Cancer, Tumor Suppressors | |
| 60385 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q9UJT2 | |
| TSKS | |
| Synthetic peptides corresponding to TSKS(testis-specific kinase substrate) The peptide sequence was selected from the N terminal of TSKS. Peptide sequence MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Porcine: 86%; Bovine: 86%; . | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction