TSKS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154878

Catalog No. NBP154878

Description

TSKS Polyclonal specifically detects TSKS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TSKS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: STK22 substrate 1, STK22S1, testis specific serine/threonine kinase substrate, Testis-specific kinase substrate, testis-specific serine kinase substrate, TSKS1, TSSKS
• Host Species: Rabbit
• Molecular Weight of Antigen: 65 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Tumor Suppressors
• Gene ID (Entrez): 60385
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9UJT2
• Gene Symbols: TSKS
• Immunogen: Synthetic peptides corresponding to TSKS(testis-specific kinase substrate) The peptide sequence was selected from the N terminal of TSKS. Peptide sequence MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Bovine: 86%; .
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG