Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSKS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | TSKS |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TSKS Polyclonal specifically detects TSKS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TSKS | |
| Polyclonal | |
| Rabbit | |
| Cancer, Tumor Suppressors | |
| STK22 substrate 1, STK22S1, testis specific serine/threonine kinase substrate, Testis-specific kinase substrate, testis-specific serine kinase substrate, TSKS1, TSSKS | |
| TSKS | |
| IgG | |
| 65 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q9UJT2 | |
| 60385 | |
| Synthetic peptides corresponding to TSKS(testis-specific kinase substrate) The peptide sequence was selected from the N terminal of TSKS. Peptide sequence MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title