Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TSPAN3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16231020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16231020 20 μL
NBP162310 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16231020 Supplier Novus Biologicals Supplier No. NBP16231020UL

Rabbit Polyclonal Antibody

TSPAN3 Polyclonal specifically detects TSPAN3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TSPAN3
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O60637
Gene Alias tetraspan TM4SF, tetraspanin 3, Tetraspanin TM4-A, tetraspanin-3, TM4-A, TM4SF8, Transmembrane 4 superfamily member 8tetraspan 3, TSPAN-3
Gene Symbols TSPAN3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TSPAN3(tetraspanin 3) The peptide sequence was selected from the middle region of TSPAN3. Peptide sequence SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10099
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.