TSPAN7/TM4SF2 Antibody (CL0262), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP25289425UL

Catalog No. NB395369

Description

TSPAN7/TM4SF2 Monoclonal antibody specifically detects TSPAN7/TM4SF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TSPAN7/TM4SF2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL0262
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: A15CCG-B7, CD231, CD231 antigen, Cell surface glycoprotein A15, Membrane component chromosome X surface marker 1, mental retardation, X-linked 58, MRX58, MXS1T-cell acute lymphoblastic leukemia associated antigen 1, T-cell acute lymphoblastic leukemia-associated antigen 1, tetraspanin 7, tetraspanin-7, TM4SF2tetraspanin protein, transmembrane 4 superfamily 2b, Transmembrane 4 superfamily member 2X chromosome, surface marker 1, transmembrane protein A15, Tspan-7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
• Quantity: 25 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 7102
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1