Learn More
Description
Specifications
Specifications
| Antigen | TSPAN7/TM4SF2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | CL0265 |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | A15CCG-B7, CD231, CD231 antigen, Cell surface glycoprotein A15, Membrane component chromosome X surface marker 1, mental retardation, X-linked 58, MRX58, MXS1T-cell acute lymphoblastic leukemia associated antigen 1, T-cell acute lymphoblastic leukemia-associated antigen 1, tetraspanin 7, tetraspanin-7, TM4SF2tetraspanin protein, transmembrane 4 superfamily 2b, Transmembrane 4 superfamily member 2X chromosome, surface marker 1, transmembrane protein A15, Tspan-7 |
| Host Species | Mouse |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
