TSPAN8/TM4SF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162380

Catalog No. NBP162380

Description

TSPAN8/TM4SF3 Polyclonal specifically detects TSPAN8/TM4SF3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TSPAN8/TM4SF3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CO-029, tetraspanin 8, TM4SF3tspan-8, Transmembrane 4 superfamily member 3tetraspanin-8, Tspan-8, Tumor-associated antigen CO-029
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 7103
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P19075
• Gene Symbols: TSPAN8
• Immunogen: Synthetic peptides corresponding to TSPAN8(tetraspanin 8) The peptide sequence was selected from the middle region of TSPAN8. Peptide sequence VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Mouse: 82%; Porcine: 75%; Guinea pig: 75%.
• Target Species: Human, Mouse, Guinea Pig
• Isotype: IgG

For Research Use Only