Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15534920UL
Description
TSR1 Polyclonal specifically detects TSR1 in Human samples. It is validated for Western Blot.Specifications
TSR1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q2NL82 | |
TSR1 | |
Synthetic peptides corresponding to TSR1(TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TSR1. Peptide sequence MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV. | |
Affinity Purified | |
RUO | |
55720 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ10534, KIAA1401, MGC131829, pre-rRNA-processing protein TSR1 homolog, TSR1, 20S rRNA accumulation, homolog (S. cerevisiae), TSR1, 20S rRNA accumulation, homolog (yeast) | |
Rabbit | |
92 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction