Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TTC15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TTC15 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB170189 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB170189 100 μg
NB170190 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB170189 Supplier Novus Biologicals Supplier No. NBP317557100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TTC15 Polyclonal antibody specifically detects TTC15 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen TTC15
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CGI-87, FLJ36862, FLJ44560, tetratricopeptide repeat domain 15, tetratricopeptide repeat protein 15, TPR repeat protein 15
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VMYSMANCLLLMKDYVLAVEAYHSVIKYYPEQEPQLLSGIGRISLQIGDIKTAEKYFQDVEKVTQKLDGLQGKI
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51112
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.