Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TTC19 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191534

 View more versions of this product

Catalog No. NBP191534

Add to cart



TTC19 Polyclonal antibody specifically detects TTC19 in Mouse, Rat, Yeast samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptide directed towards the N terminal of mouse TTC19. Peptide sequence RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ.
39 kDa
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
MGC138312, MGC19520, tetratricopeptide repeat domain 19,2010204O13Rik, tetratricopeptide repeat protein 19, mitochondrial, TPR repeat protein 19
Protein A purified
Mouse, Rat, Yeast
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit