TTC19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191534

Catalog No. NBP191534

Description

TTC19 Polyclonal specifically detects TTC19 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: TTC19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC138312, MGC19520, tetratricopeptide repeat domain 19,2010204O13Rik, tetratricopeptide repeat protein 19, mitochondrial, TPR repeat protein 19
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_082636
• Gene Symbols: TTC19
• Immunogen: Synthetic peptide directed towards the N terminal of mouse TTC19. Peptide sequence RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54902
• Target Species: Mouse, Rat, Yeast
• Form: Purified