TTC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153012

Catalog No. NBP153012

Description

TTC5 Polyclonal specifically detects TTC5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TTC5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Strap, tetratricopeptide repeat domain 5, tetratricopeptide repeat protein 5, TPR repeat protein 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91875
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N0Z6
• Gene Symbols: TTC5
• Immunogen: Synthetic peptides corresponding to TTC5(tetratricopeptide repeat domain 5) The peptide sequence was selected from the C terminal of TTC5. Peptide sequence GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Pig: 100%; Guinea pig: 92%; Equine: 92%; Rat: 92%; Canine: 85%; Mouse: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG