Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | TTC5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TTC5 Polyclonal specifically detects TTC5 in Human samples. It is validated for Western Blot.Specifications
TTC5 | |
Polyclonal | |
Rabbit | |
Q8N0Z6 | |
91875 | |
Synthetic peptides corresponding to TTC5(tetratricopeptide repeat domain 5) The peptide sequence was selected from the C terminal of TTC5. Peptide sequence GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Strap, tetratricopeptide repeat domain 5, tetratricopeptide repeat protein 5, TPR repeat protein 5 | |
TTC5 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title