Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15492720UL
Description
TTC6 Polyclonal specifically detects TTC6 in Human samples. It is validated for Western Blot.Specifications
TTC6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q86TZ1 | |
TTC6 | |
Synthetic peptides corresponding to TTC6(tetratricopeptide repeat domain 6) The peptide sequence was selected from the C terminal of TTC6. Peptide sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY. | |
Affinity Purified | |
RUO | |
319089 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C14orf25, NCRNA00291, TTC6 tetratricopeptide repeat domain 6 | |
Rabbit | |
59 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction