Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TTLL1 Antibody, Novus Biologicals™

TTLL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP213491 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP213491 0.1 mL
NB438491 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP213491 Supplier Novus Biologicals Supplier No. NBP213491
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TTLL1 Polyclonal specifically detects TTLL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen TTLL1
Applications Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C22orf7, catalytic subunit of neural tubulin polyglutamylase, EC 6.-, HS323M22B, KIAA0173, PGs3, probable tubulin polyglutamylase TTLL1, Tubulin polyglutamylase complex subunit 3, tubulin tyrosine ligase-like 1, tubulin tyrosine ligase-like family, member 1, tubulin-tyrosine ligase, Tubulin--tyrosine ligase-like protein 1
Gene Symbols TTLL1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25809
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.