Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tubulin alpha-8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Tubulin alpha-8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Tubulin alpha-8 Polyclonal specifically detects Tubulin alpha-8 in Mouse samples. It is validated for Western Blot.Specifications
Tubulin alpha-8 | |
Polyclonal | |
Rabbit | |
Q9JJZ2 | |
51807 | |
Synthetic peptides corresponding to the N terminal of Tuba8. Immunizing peptide sequence ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Alpha-tubulin 8, TUBAL2Tubulin alpha chain-like 2, tubulin alpha-8 chain, tubulin, alpha 8 | |
TUBA8 | |
IgG | |
50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title