Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Tubulin Beta 4 Antibody, Novus Biologicals™

Tubulin Beta 4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15700520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15700520 20 μL
NBP157005 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15700520 Supplier Novus Biologicals Supplier No. NBP15700520UL

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Tubulin Beta 4 Polyclonal specifically detects Tubulin Beta 4 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen Tubulin Beta 4
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P04350
Gene Alias TUBB5beta-5, Tubulin 5 beta, tubulin beta-4 chain, tubulin, beta 4, tubulin, beta, 5
Gene Symbols TUBB4A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TUBB4 (tubulin, beta 4) The peptide sequence was selected from the N terminal of TUBB4. Peptide sequence TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cytoskeleton Markers
Primary or Secondary Primary
Gene ID (Entrez) 10382
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.