Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TUFM Antibody (CL2242), Novus Biologicals™

TUFM Antibody (CL2242), Novus Biologicals™
SDP

Catalog No. NBP236751 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP236751 0.1 mL
NB397086 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP236751 Supplier Novus Biologicals Supplier No. NBP236751
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody has been used in 1 publication

TUFM Monoclonal specifically detects TUFM in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen TUFM
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL2242
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunoprecipitation, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P49411
Gene Alias EFTu, EF-Tu, EFTUCOXPD4, EF-TuMT, elongation factor Tu, mitochondrial, P43, Tu translation elongation factor, mitochondrial
Gene Symbols TUFM
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7284
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.