Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TUFM Antibody (CL2242), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

$405.00 - $670.00

Specifications

Antigen	TUFM
Clone	CL2242
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB397086 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23675125UL	25 μL	Each for $405.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP236751 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP236751	0.1 mL	Each for $670.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TUFM Monoclonal specifically detects TUFM in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	TUFM
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human, Rat
Gene Accession No.	P49411
Gene ID (Entrez)	7284
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Primary or Secondary	Primary
Reconstitution	Protein A purified

Clone	CL2242
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	EFTu, EF-Tu, EFTUCOXPD4, EF-TuMT, elongation factor Tu, mitochondrial, P43, Tu translation elongation factor, mitochondrial
Gene Symbols	TUFM
Isotype	IgG1
Purification Method	Protein A purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TUFM Antibody (CL2242), Novus Biologicals™

Specifications

Description

Specifications

Documents